General Information

  • ID:  hor005384
  • Uniprot ID:  P01250
  • Protein name:  Thymopoietin-2
  • Gene name:  NA
  • Organism:  Bos taurus (Bovine)
  • Family:  Thymopoietin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003677 DNA binding; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  PEFLEDPSVLTKEKLKSELVANNVTLPAGEQRKDVYVELYLQSLTALKR
  • Length:  49(1-49)
  • Propeptide:  PEFLEDPSVLTKEKLKSELVANNVTLPAGEQRKDVYVELYLQSLTALKR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone of the spleen with pleiotropic actions on prothymocytes, mature T-cells, the nicotinic acetylcholine receptor, and pituitary corticotrophs.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01250-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01250-F1.pdbhor005384_AF2.pdbhor005384_ESM.pdb

Physical Information

Mass: 643076 Formula: C251H412N64O78
Absent amino acids: CHIMW Common amino acids: L
pI: 4.92 Basic residues: 7
Polar residues: 11 Hydrophobic residues: 18
Hydrophobicity: -39.59 Boman Index: -8461
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 107.35
Instability Index: 4919.18 Extinction Coefficient cystines: 2980
Absorbance 280nm: 62.08

Literature

  • PubMed ID:  7306506
  • Title:  Complete amino acid sequences of bovine thymopoietins I, II, and III: closely homologous polypeptides.